livegoodindia.com

Delivery address
135-0061

Washington

Change
buy later

Change delivery address

The "delivery date" and "inventory" displayed in search results and product detail pages vary depending on the delivery destination.
Current delivery address is
Washington (135-0061)
is set to .
If you would like to check the "delivery date" and "inventory" of your desired delivery address, please make the following changes.

Select from address book (for members)
Login

Enter the postal code and set the delivery address (for those who have not registered as members)

*Please note that setting the delivery address by postal code will not be reflected in the delivery address at the time of ordering.
*Inventory indicates the inventory at the nearest warehouse.
*Even if the item is on backorder, it may be delivered from another warehouse.

  • Do not change
  • Check this content

    glp 1 with alcohol GLP-1 Medications and Alcohol: A Guide

    19.38 USD(tax included)

    /21.53 USD (Excluding tax)

    Sales unit: 1 piece

    Application number: / Manufacturer: / Model number: 93523816167 / JAN code: / AS ONE / NAVIS Product number:

    Shipping Estimate
    USA
    • USA
    • CAN

    Ships within 48 hours · Estimated delivery Jun 16 - Jun 21

    Shipping Notes
    • Free Standard Shipping on $100+ Orders to the USA.
    • Except Preorder products are shipped in 48 hours.
    • Delivery to the USA:
    1. Standard Shipping : 3-10 business days
    • If time is of the essence, please consider selecting expedited delivery for faster service.
    Exchange/Return Notes
    • We offer a 30-day return/exchange service after receiving.
    • Final sale items are not eligible for returns or exchanges.
    • To process your return/exchange, please contact us at [email protected]
    • Please click here for more details>>> Return & Exchange Policy

    Application number
    Manufacturer
    Model number 93523816167
    JAN code
    Sales unit 1 piece
    Price 19.38 USD (tax included) / 21.53 USD (Excluding tax)

    *Additional shipping fees will be charged for this product in Okinawa Prefecture, remote islands, some other areas, and mountain areas. Please note that we may not be able to deliver depending on the region. If we are unable to deliver your order after placing your order, Askul will contact you.
    Please note the following points as this item is directly shipped.

    • Additional shipping fees will be charged for this product in Okinawa Prefecture, remote islands, some other areas, and mountain areas. Please note that we may not be able to deliver depending on the region. If we are unable to deliver your order after placing your order, Askul will contact you.
    • This product may not come with a delivery note issued by Askul. Customers who wish to receive a delivery note issued by Askul can print it out as a PDF file from the usage history on this site after receiving the product.
    • It is not delivered in Askul cardboard or a bag.
    • We cannot accept changes, cancellations, returns, or exchanges after the order has been placed due to the customer's convenience.
    • If we discover after placing an order that the product cannot be delivered, we may cancel your order.
    • If it becomes clear after placing your order that the item is temporarily out of stock, it will be delivered as soon as it becomes available.
    • Popular items
    glp 1 with alcohol GLP-1 Medications and Alcohol: A Guide

    This image is a representative image. Please check the specifications for details.

    glp 1 with alcohol GLP-1 Medications and Alcohol: A Guide

    Stock: Slightly

    Displaying inventory at the nearest warehouse.
    Even if the item is on "backorder", it may be possible to deliver it from another warehouse.

    Delivery date: 2026-06-17 Later
    Help

    The delivery date is an estimate. Please check the checkout screen for detailed delivery dates.

    About delivery date display

    Direct delivery product

    LAB & Healthcare SHOP

    Shipping charges for products from this shipping source will be borne by us.

    19.38 USD (tax included)

    / 21.53 USD (Excluding tax)

    Help You can easily compare prices, specifications, etc. by arranging the products you want to compare in a table.
    Please note

    Please note

    There are some items that you should be aware of when purchasing, such as special delivery times. The information is listed on the product details screen, so please be sure to check the product details screen before purchasing.

    No returns

    No returns

    We cannot accept returns due to customer's convenience.

    direct delivery product

    direct delivery product

    This product is delivered directly from the shipping source. It will be delivered separately from general products. The estimated delivery date is displayed on the checkout screen. This product cannot be returned due to customer convenience.

    What is Product Environmental Score?
    Product features Will Louisiana Blue Pay for GLP 1s for Weight Loss? Straight Talk by Blue Cross and Blue Shield of Louisiana Retatrutide Weight Loss GLP 1, GIP, and Glucagon Receptor Therapy Chart: 1 in 8 Americans Now Use GLP 1 Drugs for Weight Loss Statista GLP 1 Cost Estimator Check Your Insurance Coverage WW GLP 1(7 36), amide107444 51 9HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR NH
    Manufacturer name - Brand name -
    remarks [About returns] We cannot accept returns due to customer's convenience.
    Product details Click here for the manufacturer's site Open in new window Easy to find furniture and interiors! Click here for Askul's general furniture TOP page. Open in new window Consultation on layout, various construction works, and delivery dates! Click here for the ASKUL office creation service. Open in new window

    Disclaimer
    In this service, we strive to display the latest product information on the site, but product standards and specifications (capacity, packaging, raw materials, country of origin, etc.) may change due to manufacturer circumstances. For this reason, the product information displayed on the site may differ from the actual product you receive, so please be sure to check the product label and precautions of the product you receive before use. If you require further product information, please contact the manufacturer. Also, the notation "set" in the sales unit does not guarantee delivery in a box. Thank you for your understanding.

    Customer reviews

    There are no reviews posted. We look forward to hearing your review comments.


    • glp 1 with alcohol GLP-1 Medications and Alcohol: A Guide
    • glp 1 with alcohol GLP-1 Medications and Alcohol: A Guide

    The product has been added to your cart


    Total items

    piece

    Total Amount

    (tax included)